CDS

Accession Number TCMCG023C03701
gbkey CDS
Protein Id PIN23535.1
Location join(202859..202887,203014..203173)
Organism Handroanthus impetiginosus
locus_tag CDL12_03745

Protein

Length 62aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA324125, BioSample:SAMN05195323
db_source NKXS01000558.1
Definition hypothetical protein CDL12_03745 [Handroanthus impetiginosus]
Locus_tag CDL12_03745

EGGNOG-MAPPER Annotation

COG_category C
Description Scaffold protein for the de novo synthesis of iron- sulfur (Fe-S) clusters within mitochondria, which is required for maturation of both mitochondrial and cytoplasmic 2Fe-2S and 4Fe-4S proteins
KEGG_TC -
KEGG_Module -
KEGG_Reaction -
KEGG_rclass -
BRITE ko00000        [VIEW IN KEGG]
ko03029        [VIEW IN KEGG]
KEGG_ko ko:K22068        [VIEW IN KEGG]
EC -
KEGG_Pathway -
GOs GO:0003674        [VIEW IN EMBL-EBI]
GO:0003824        [VIEW IN EMBL-EBI]
GO:0005198        [VIEW IN EMBL-EBI]
GO:0005488        [VIEW IN EMBL-EBI]
GO:0005506        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0005739        [VIEW IN EMBL-EBI]
GO:0005759        [VIEW IN EMBL-EBI]
GO:0006807        [VIEW IN EMBL-EBI]
GO:0006873        [VIEW IN EMBL-EBI]
GO:0006875        [VIEW IN EMBL-EBI]
GO:0006879        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0008152        [VIEW IN EMBL-EBI]
GO:0008198        [VIEW IN EMBL-EBI]
GO:0009987        [VIEW IN EMBL-EBI]
GO:0010467        [VIEW IN EMBL-EBI]
GO:0016740        [VIEW IN EMBL-EBI]
GO:0016782        [VIEW IN EMBL-EBI]
GO:0019538        [VIEW IN EMBL-EBI]
GO:0019725        [VIEW IN EMBL-EBI]
GO:0030003        [VIEW IN EMBL-EBI]
GO:0031974        [VIEW IN EMBL-EBI]
GO:0036455        [VIEW IN EMBL-EBI]
GO:0042592        [VIEW IN EMBL-EBI]
GO:0043167        [VIEW IN EMBL-EBI]
GO:0043169        [VIEW IN EMBL-EBI]
GO:0043170        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0043233        [VIEW IN EMBL-EBI]
GO:0044238        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044429        [VIEW IN EMBL-EBI]
GO:0044444        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0046872        [VIEW IN EMBL-EBI]
GO:0046914        [VIEW IN EMBL-EBI]
GO:0046916        [VIEW IN EMBL-EBI]
GO:0048037        [VIEW IN EMBL-EBI]
GO:0048878        [VIEW IN EMBL-EBI]
GO:0050801        [VIEW IN EMBL-EBI]
GO:0051536        [VIEW IN EMBL-EBI]
GO:0051537        [VIEW IN EMBL-EBI]
GO:0051539        [VIEW IN EMBL-EBI]
GO:0051540        [VIEW IN EMBL-EBI]
GO:0051604        [VIEW IN EMBL-EBI]
GO:0055065        [VIEW IN EMBL-EBI]
GO:0055072        [VIEW IN EMBL-EBI]
GO:0055076        [VIEW IN EMBL-EBI]
GO:0055080        [VIEW IN EMBL-EBI]
GO:0055082        [VIEW IN EMBL-EBI]
GO:0065007        [VIEW IN EMBL-EBI]
GO:0065008        [VIEW IN EMBL-EBI]
GO:0070013        [VIEW IN EMBL-EBI]
GO:0071704        [VIEW IN EMBL-EBI]
GO:0097428        [VIEW IN EMBL-EBI]
GO:0098771        [VIEW IN EMBL-EBI]
GO:1901564        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGGAGGAAGTCGTGTCAATCAAGAATACGGAAATTGCAAAACATCTTTCTCTTCCACCAGTGAAGCTCCATTGCAGCATGCTTGCGGAGGATGCAATAAAGGCTGCTGTAAAAGACTATGAGGCAAAGCGTTTAAAATCAAACGGGAGTCAAGATGCTAAACCTATGGAGAAAGCTGCTGATGCTTGA
Protein:  
MEEVVSIKNTEIAKHLSLPPVKLHCSMLAEDAIKAAVKDYEAKRLKSNGSQDAKPMEKAADA